PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02749.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 607aa    MW: 67976.6 Da    PI: 6.5757
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02749.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.6e-23158258198
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f+k+lt sd++++g +++ +k+a+e+       + ++++  +l+ +d++g +W++k+i+r++++r++lt+GW+ Fv++++L +gD 
  Rsa1.0_02749.1_g00003.1 158 FVKILTASDTSTHGGFSVLRKHATEClppldmtQAIPTQ--ELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDA 241
                              89****************************977555555..8******************************************** PP

                              EEEEE-SSSEE..EEEEE- CS
                       B3  80 vvFkldgrsefelvvkvfr 98 
                              +vF   + +++ l+v+v+r
  Rsa1.0_02749.1_g00003.1 242 FVFL--RGENGDLRVGVRR 258
                              ****..3488889***998 PP

2Auxin_resp97.32.2e-32284363183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha++t+++F v+Y+Pr   s+F+v v+k+ +a+k+ +s+G+Rf+m+fe+e+s+er ++Gt+vgv dl++ +Wp S WrsL+
  Rsa1.0_02749.1_g00003.1 284 ASHAVNTQTMFLVFYKPRI--SQFIVGVNKYIEAMKHGFSLGTRFRMRFEGEESPERIFTGTIVGVGDLSS-QWPASTWRSLQ 363
                              789***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-39143287IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.2E-38151273IPR015300DNA-binding pseudobarrel domain
CDDcd100172.85E-20156258No hitNo description
SMARTSM010193.0E-21158260IPR003340B3 DNA binding domain
PROSITE profilePS5086311.998158260IPR003340B3 DNA binding domain
PfamPF023624.8E-21158258IPR003340B3 DNA binding domain
PfamPF065075.7E-30284363IPR010525Auxin response factor
PfamPF023092.9E-13496591IPR033389AUX/IAA domain
SuperFamilySSF542773.14E-12499579No hitNo description
PROSITE profilePS5174525.792503595IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MANVDGDDSR SSSPSESKFH FFVVVVVVVV VVFIIDSVLC SVISSCTYQD QLYTELWKAC  60
AGPLVDVPLT RERVFYFPQG HMEQLVASTN QGIESEKIPD FKLPPKILCQ VLNVTLKAEH  120
ETDEVYAQIT LKPEEDQSEP TSLDQPIVEP AKQMFHSFVK ILTASDTSTH GGFSVLRKHA  180
TECLPPLDMT QAIPTQELVT RDLHGFEWRF KHIFRGQPRR HLLTTGWSTF VSSKRLVAGD  240
AFVFLRGENG DLRVGVRRLA RHQNTMPASV ISSQSMHLGV LATASHAVNT QTMFLVFYKP  300
RISQFIVGVN KYIEAMKHGF SLGTRFRMRF EGEESPERIF TGTIVGVGDL SSQWPASTWR  360
SLQVQWDEPT TVQRPDKVSP WEIEPFLPSS PVSAPAQQSQ PKSKRSKPIE SSVLSPGQAS  420
FFPQSQDPTK ASLKQFQAEA LPPPLPPPPA SCSYRLFGFD LTSNPPAPIP PDKQPVDTCG  480
AAKCQDPITP TSANEPKKQQ TSRTRTKVQM QGIAVGRAVD LTLLKSYDEL IKELEEMFEI  540
QGQLLPRDKW IVVFTDDEGD MMLAGDDPWN EFCKMAKKIF IYSSDEVKKM TRRMKSCSSL  600
ENEVSMD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1655038617355Auxin response factor 1
4ldw_A1e-1655038617355Auxin response factor 1
4ldv_A1e-1655038617355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794810.0JN979481.1 Brassica rapa subsp. pekinensis auxin response factor 18-1 (ARF18-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009116845.10.0PREDICTED: auxin response factor 18
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D3DUY10.0A0A0D3DUY1_BRAOL; Auxin response factor
STRINGBra007632.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18